RetrogeneDB ID: | retro_chof_1100 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_199869:3863..4105(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCHOG00000003891 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 74.12 % |
| Parental protein coverage: | 51.9 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | QVTKEDFATFDYILCMDESNLRDLNRKGSAVKNRKA-KIELLGSYDPQKQLIIEDPYYGNDSDFETVY-Q |
| ..TKEDFATFD.ILCMDES.LRDLNRKG..VKN.K..KIELL.SYDP.KQL.IEDPYY.NDS.FET...Q | |
| Retrocopy | KITKEDFATFDDILCMDESSLRDLNRKGREVKNCKV>KIELLRSYDPHKQL-IEDPYYSNDSNFETMH<Q |
| Parental | QCVRCCKAF-LEKSQ |
| QC..CCK.F.LEKS. | |
| Retrocopy | QCIWCCKEF<LEKSR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |