RetrogeneDB ID: | retro_dnov_1393 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_19442:7566..7808(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000017382 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 54.76 % |
| Parental protein coverage: | 52.53 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWIIDSGAVSDWNVGRSPDPRAVSCLRNHGIK |
| M.EQA..S..FV.L.NIC.SPIAE.VFRKL.T.QNISDNW.IDS.A.S.......PD.....C...H.I. | |
| Retrocopy | MVEQA--STCFVFLDNICQSPIAETVFRKLATNQNISDNWSIDSAATSTYAIENPPDY*G*NCMKKHDIP |
| Parental | TA-HNARQITTEDF |
| ...H.A.Q.TTED. | |
| Retrocopy | IS<HAAQQVTTEDY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 57 .56 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 15 .81 RPM |
| SRP012922_heart | 0 .00 RPM | 27 .84 RPM |
| SRP012922_kidney | 0 .00 RPM | 41 .89 RPM |
| SRP012922_liver | 0 .00 RPM | 23 .22 RPM |
| SRP012922_lung | 0 .00 RPM | 36 .65 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 19 .56 RPM |
| SRP012922_spleen | 0 .00 RPM | 43 .04 RPM |